HORDB

ID: hor006947
Uniprot ID: P13432??24-146)
Protein name: SMR1 protein
Gene name: gh2
Organism: Rattus norvegicus
Family: NA
Source: Animal
Expression: Expressed predominantly in the acinar cells of the submandibular gland and to lesser extent in the prostate.
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
GO MF: GO:0005576 extracellular region
GO BP: GO:0030414 peptidase inhibitor activity; GO:0005179 hormone activity; GO:0004866 endopeptidase inhibitor activity
GO CC: GO:0071222 cellular response to lipopolysaccharide; GO:0010466 negative regulation of peptidase activity; GO:0051930 regulation of sensory perception of pain

Sequence: RGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK
Length: 123
Propeptide: MKSLYLIFGLWILLACFQSGEGVRGPRRQHNPRRQQDPSTLPHYLGLQPDPNGGQIGVTITIPLNLQPPRVLVNLPGFITGPPLVVQGTTEYQYQWQLTAPDPTPLSNPPTQLHSTEQANTKTDAKISNTTATTQNSTDIFEGGGK
Signal peptide: MKSLYLIFGLWILLACFQSGEG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: